DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and rnf151

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 / 100004674 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio


Alignment Length:236 Identity:46/236 - (19%)
Similarity:77/236 - (32%) Gaps:70/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KSSCLFCNE----WFDAQTFTEHLIHC----------------------GQVLEECPN---GCQA 73
            |.:.:||.|    |...|      :.|                      |::..:|.|   ||:|
Zfish    34 KCNHVFCKECILQWMKRQ------VKCPCCRQSIDQNQMLVLFKLSKSIGRLSVKCRNGQQGCRA 92

  Fly    74 FIPRIRMRSHLKECPRN----QHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNE--- 131
            ..|......|:..||..    .|....||.:...:...|:.......:.....||:....|:   
Zfish    93 TFPLSNEYLHISTCPYEWQICPHEGCGQQVLRKDVQAHDQSCTHWRQLCPMGCGTLLVRENQTQH 157

  Fly   132 ----EIRQRLHLITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYC 192
                |::||.     :...|||..:..           :|||:|:...:|.|    |.:..:...
Zfish   158 NCYRELQQRY-----LAERRKQRAIAA-----------NLRRKMQRMQSRMA----QIKRQINLM 202

  Fly   193 CDITQSLK-EQVESRLDEAQKLVNQLSADVTYHQNQLNDNI 232
            |   :||: ..:|:...|........|...:.|::..|..|
Zfish   203 C---ESLEVGDLETEAGEGTSAWTDASPSSSRHRHTYNSRI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 9/58 (16%)
MATH_TRAF_C 334..473 CDD:238168
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 7/29 (24%)
zf-TRAF 102..157 CDD:280357 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.