DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9981 and stoml3

DIOPT Version :9

Sequence 1:NP_001259610.1 Gene:CG9981 / 32609 FlyBaseID:FBgn0030746 Length:1060 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:234 Identity:45/234 - (19%)
Similarity:78/234 - (33%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WFTFLPLNFYEQFRRAVYF--------------YFLIITIVSFFVNETISPLVSLLP---LLFVM 84
            ||.   :...:::.|||.|              ...::.....|:...:..:...:|   :|...
 Frog    51 WFC---VKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRVISFAIPPQEILTKD 112

  Fly    85 IITALKEGLEDY---SRSKSDKLVNTARV-------TVIRN------------GKEEII-NSQFI 126
            .:|...:|:..|   |..|:...||...:       |.:||            .:|||. |.|.|
 Frog   113 SVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANILANREEIAHNIQSI 177

  Fly   127 ---------VPGDLVVVRNDGDVPCDL--VLLQSSSADRKCFVNTANLDGETNLKTICVPTNYLL 180
                     |..|.|.:| |..:|..:  .:...:.|.|:........:||.|........:.::
 Frog   178 LDHATHKWGVKVDRVEMR-DVRLPVQMQRAMAAEAEAAREARAKVVAAEGEMNASRALKEASLVI 241

  Fly   181 AGD------HELQGKDCIVCEPSSADLYTFNGRLELRSG 213
            |..      ..||..:.|..|.:|..::..  .:||..|
 Frog   242 AESPAALQLRYLQTLNTIAAENNSTIVFPL--PIELMQG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9981NP_001259610.1 PhoLip_ATPase_N 20..66 CDD:292826 6/42 (14%)
ATPase-Plipid 28..1051 CDD:273734 45/234 (19%)
E1-E2_ATPase 84..>189 CDD:278548 30/144 (21%)
Cation_ATPase <489..568 CDD:289987
HAD_like <758..807 CDD:304363
PhoLip_ATPase_C 804..1050 CDD:292829
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 36/203 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.