DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9981 and LOC100494266

DIOPT Version :9

Sequence 1:NP_001259610.1 Gene:CG9981 / 32609 FlyBaseID:FBgn0030746 Length:1060 Species:Drosophila melanogaster
Sequence 2:XP_002932551.2 Gene:LOC100494266 / 100494266 -ID:- Length:457 Species:Xenopus tropicalis


Alignment Length:213 Identity:45/213 - (21%)
Similarity:86/213 - (40%) Gaps:56/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   832 LAFLVLFYCYKNIIITGCMALYQVYDLYSATNVYNSIYLW-LFDIVYISFSFTVLAICDKDYSEE 895
            |.|....|..::||:...:...:|..|  :.:.:.|...| |.|:..::.|.    :.|..:||.
 Frog   168 LTFGSFIYTVEDIIMFPSLNSSEVSQL--SLDSFVSKGDWSLLDVAVVNQSL----VGDGQFSEV 226

  Fly   896 TLLSHPELYKPLAHNRQASMGVFSLWILNGFVQCFIIFFFTYAMLNDANVLFNGGQTASFQTFGT 960
            |.:        :...|.:.:.|.:|.:    ..||:||      |:.|::....|:|..|:    
 Frog   227 TYM--------ITMKRSSVVFVINLIV----PACFLIF------LDFASMFIRIGETLEFK---- 269

  Fly   961 MLITIIVIVGNLKLLLVAHYMTYRN-------------FAMILASIAAFMLTTYLYNLYTSGELY 1012
                |.:::|...|||:.:.|...:             .|:::.||...:||.|:..|       
 Frog   270 ----ITIVLGFSVLLLILNDMMPSSDNPPMLGIFCVVCLAIMVISILGCILTNYMLTL------- 323

  Fly  1013 DVYNQFLSSLPIWLFTII 1030
               :....::|.|:.|:|
 Frog   324 ---SDMQPNVPNWIKTLI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9981NP_001259610.1 PhoLip_ATPase_N 20..66 CDD:292826
ATPase-Plipid 28..1051 CDD:273734 45/213 (21%)
E1-E2_ATPase 84..>189 CDD:278548
Cation_ATPase <489..568 CDD:289987
HAD_like <758..807 CDD:304363
PhoLip_ATPase_C 804..1050 CDD:292829 45/213 (21%)
LOC100494266XP_002932551.2 LGIC_ECD 24..234 CDD:355788 16/79 (20%)
LIC 43..434 CDD:273305 45/213 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52404
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.