DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9981 and gse1

DIOPT Version :9

Sequence 1:NP_001259610.1 Gene:CG9981 / 32609 FlyBaseID:FBgn0030746 Length:1060 Species:Drosophila melanogaster
Sequence 2:XP_017949012.1 Gene:gse1 / 100379977 XenbaseID:XB-GENE-5880740 Length:1889 Species:Xenopus tropicalis


Alignment Length:290 Identity:59/290 - (20%)
Similarity:101/290 - (34%) Gaps:81/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 ETDQPCRVNASNLNEELGQVNILFSDKTGTLTKNLMKFVNCYVPGTNYQLQNTHLVSEGT----- 427
            |..||.|  .|:..|..|..:..|   ...|.|:...|:|    .....||.:...:||:     
 Frog  1311 EKYQPQR--ESSAMEHAGYSHAPF---LAELEKSTQTFLN----QQRTSLQQSGQTAEGSLLHKP 1366

  Fly   428 -DEKFELEKLDADAAVLFEALAVCHTVEVLQEVGDKTLESSESVSEQSHLMSR------NIVDRY 485
             ....:|.....||..:::        |.||:  .:.|.|...:.|:....:|      ::.|.|
 Frog  1367 CTSYRQLPSRTRDAMFVYD--------EFLQQ--HRRLVSKLDLEERRRKEAREKGYYYDLDDSY 1421

  Fly   486 QASSPDE-KALLEGCASLGLVYEGQENDVLSICRYPSAEKVQFKRLHVLEFSSERQRM------- 542
            ..|..:| :|.|...|         |...|.:  ..|:|||:|.::..|....:|:|:       
 Frog  1422 DESDEEEVRAHLRRVA---------EQPPLKL--DTSSEKVEFLQIFGLTTQQDRERLLQEKRRK 1475

  Fly   543 -SVIVRDQSDTIWLYSKGAESAIFPRCKASPLVEQTDAQI--------TKYAQNGLR---TMAVG 595
             ..::|::|.                   ||...|...|.        |:::.:.|.   .:...
 Frog  1476 RRRMLRERSQ-------------------SPPTVQNKRQTPPPNSPLSTRFSPDDLNNSPNLEEK 1521

  Fly   596 RRMLTDDELFHFEELYRKANTQLSNRNELI 625
            ::.||..:|.|.....|:...:|....|.|
 Frog  1522 KKFLTFFDLAHISAERRRDKEKLVEMLEAI 1551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9981NP_001259610.1 PhoLip_ATPase_N 20..66 CDD:292826
ATPase-Plipid 28..1051 CDD:273734 59/290 (20%)
E1-E2_ATPase 84..>189 CDD:278548
Cation_ATPase <489..568 CDD:289987 16/87 (18%)
HAD_like <758..807 CDD:304363
PhoLip_ATPase_C 804..1050 CDD:292829
gse1XP_017949012.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.