DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-41 and BOLA2-SMG1P6

DIOPT Version :9

Sequence 1:NP_523369.2 Gene:mei-41 / 32608 FlyBaseID:FBgn0004367 Length:2517 Species:Drosophila melanogaster
Sequence 2:NP_001307551.1 Gene:BOLA2-SMG1P6 / 107282092 HGNCID:53563 Length:305 Species:Homo sapiens


Alignment Length:264 Identity:56/264 - (21%)
Similarity:97/264 - (36%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LTKMLG----FTCVQEFTCKY--HRLLTAMVLPHCIVNPLCKGVLVLIAKQMQKHIGTLFSISFL 872
            :..:||    :|...|.:.:|  .:|...:...|.:.:|  .||..:..:........|:.:  :
Human    53 VVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVLPSP--GGVGQVRGETAASETQVLYRV--M 113

  Fly   873 RIYT---HVFLTEEP-ELANSCIELVVSCTQSS------------LQQLMN-----ADVKQTVAE 916
            |..|   .||.:|.. ..||.|:.:::.....|            |.||.|     .|...:|..
Human   114 RCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVITYGLDQLENCQTCGTDYIISVLN 178

  Fly   917 LLIYFNRNPTFVMRSFQSLLQLSIGSLEELSSQTANAEFANFIAERFLGVITY--FESCLSEPSF 979
            ||       |.::....:.|..|.  :|:|...::...|..:..|:.:..:.:  :::.||    
Human   179 LL-------TLIVEQINTKLPSSF--VEKLFIPSSKLLFLRYHKEKEVVAVAHAVYQAMLS---- 230

  Fly   980 EKPLKE----ETLYSLGQIMRFVGSQHVTQFRFKIIAMLSFVHTLQEPRLQRICLKIWHIFL--H 1038
               ||.    ||.|.|     .:|..        ..|:.:.:|:||.|   ..|.:|.|...  |
Human   231 ---LKNIPVLETAYKL-----ILGEM--------TCALNNLLHSLQLP---EACSEIKHEAFKNH 276

  Fly  1039 VVNV 1042
            |.||
Human   277 VFNV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-41NP_523369.2 UME 955..1060 CDD:214825 23/96 (24%)
FAT 1653..1985 CDD:280429
PIKKc_ATR 2181..2448 CDD:270625
FATC 2486..2517 CDD:280430
BOLA2-SMG1P6NP_001307551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.