Sequence 1: | NP_727963.1 | Gene: | Fur2 / 32604 | FlyBaseID: | FBgn0004598 | Length: | 1682 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274481.1 | Gene: | rspo4 / 570865 | ZFINID: | ZDB-GENE-110103-2 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 59/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1064 RTCVPC--EPNCASCQDHPEYCTSCDHHLVMHEHKCYSACPLDTY---ETEDNKCAFCHS-TCAT 1122
Fly 1123 CNGPTDQD-CITCRSSRYAWQNKCLISCPDGFYADKKRLECMPCQEGC-----------KTCTSN 1175
Fly 1176 GVCSECLQNWTLNKRDKCIVSGSEGCSESEFYSQVEGQCRPCHASCGSCNGPADTSCTSCPPNRL 1240
Fly 1241 LEQSRCVSGCRE 1252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fur2 | NP_727963.1 | S8_pro-domain | 242..318 | CDD:293079 | |
Peptidases_S8_Protein_convertases_Kexins_Fur in-like | 375..674 | CDD:173789 | |||
Peptidase_S8 | 411..700 | CDD:278510 | |||
P_proprotein | 761..849 | CDD:279782 | |||
Furin-like | 966..1126 | CDD:279142 | 18/67 (27%) | ||
FU | 970..1013 | CDD:238021 | |||
FU | 1017..1067 | CDD:238021 | 1/2 (50%) | ||
FU | 1063..1106 | CDD:214589 | 12/43 (28%) | ||
GF_recep_IV | 1068..1232 | CDD:291509 | 39/181 (22%) | ||
FU | 1116..1163 | CDD:238021 | 13/48 (27%) | ||
FU | 1211..1255 | CDD:214589 | 9/42 (21%) | ||
FU | 1259..1301 | CDD:214589 | |||
FU | 1304..1348 | CDD:214589 | |||
FU | 1356..1403 | CDD:238021 | |||
FU | 1401..1444 | CDD:214589 | |||
rspo4 | NP_001274481.1 | Furin-like_2 | 33..135 | CDD:292535 | 29/110 (26%) |
FU | 84..126 | CDD:214589 | 14/44 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1404 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |