DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur2 and Rspo4

DIOPT Version :10

Sequence 1:NP_727963.1 Gene:Fur2 / 32604 FlyBaseID:FBgn0004598 Length:1682 Species:Drosophila melanogaster
Sequence 2:XP_006235324.1 Gene:Rspo4 / 499918 RGDID:1563415 Length:228 Species:Rattus norvegicus


Alignment Length:181 Identity:48/181 - (26%)
Similarity:65/181 - (35%) Gaps:53/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1072 NCASCQ--DHPEYCTSCDHHL--------VMHEHKCYSACPLDTY---ETEDNKCAFCHSTCATC 1123
            ||..|.  .....|::|...|        :....||...|||..:   ..|.|:|..|.:||.:|
  Rat    34 NCTGCVICSEENGCSTCQQRLFLFIRREGIRQYGKCVHDCPLGFFGIRGQEANRCKKCGATCESC 98

  Fly  1124 NGPTDQD-CITCRSSRYAWQNKCLISCPDGFYADKKRLECMPCQEGCK--------TCTSNGVCS 1179
               ..|| ||.|:...:.::.|||.:||.|....:...|   |||.|:        .|..||  .
  Rat    99 ---FSQDFCIRCKRRFHLYKGKCLPTCPPGTLTHQSTRE---CQEECEPSPWGSWSPCIHNG--K 155

  Fly  1180 ECLQNWTLNKRDK------------C-IVSGSEGCSESEFYSQVEGQCRPC 1217
            .|...|.|..|.:            | ::|.|..|...          |||
  Rat   156 TCGSGWGLETRVREAGPAKQEEMASCRVISESRKCPIK----------RPC 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Fur2NP_727963.1 S8_pro-domain 242..318 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 375..674 CDD:173789
P_proprotein 761..849 CDD:460225