DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur2 and Rspo3

DIOPT Version :9

Sequence 1:NP_727963.1 Gene:Fur2 / 32604 FlyBaseID:FBgn0004598 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_001094460.1 Gene:Rspo3 / 498997 RGDID:1563246 Length:276 Species:Rattus norvegicus


Alignment Length:247 Identity:56/247 - (22%)
Similarity:75/247 - (30%) Gaps:97/247 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   997 NTCVSRCPPRSFPNQVGICWPCHDTCETCAGAGPDSCLTCAPAHLHVID------LAVCLQFCPD 1055
            |....|...|..||   :...|...|.||:..  :.||:|.|....|::      :.|||..||.
  Rat    23 NATRGRRQRRMHPN---VSQGCQGGCATCSDY--NGCLSCKPRLFFVLERIGMKQIGVCLSSCPS 82

  Fly  1056 GYFENSRNRTCVPCEPNCASCQDHPEYCTSCDHHLVMHEHKCYSACPLDTYETEDNKCAFCHSTC 1120
            ||:                                             .|...:.|||..|.:.|
  Rat    83 GYY---------------------------------------------GTRYPDINKCTKCKADC 102

  Fly  1121 ATCNGPTDQDCITCRSSRYAWQNKCLISCPDGFYADKKRLECM--------------PCQEGCKT 1171
            .||.  ....|..|:|..|....|||.|||:|..|....:||:              ||.:..||
  Rat   103 DTCF--NKNFCTKCKSGFYLHLGKCLDSCPEGLEASNHTMECVSIVHCEASDWSSWSPCMKKGKT 165

  Fly  1172 C------------------TSNGVCSECLQNWTLNKRDKCIVSGSEGCSESE 1205
            |                  ....:|....:..|      |||...: ||:.|
  Rat   166 CGFKRGTETRVRDILQHPSAKGNLCPPTSETRT------CIVQRKK-CSKGE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur2NP_727963.1 S8_pro-domain 242..318 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 375..674 CDD:173789
Peptidase_S8 411..700 CDD:278510
P_proprotein 761..849 CDD:279782
Furin-like 966..1126 CDD:279142 29/134 (22%)
FU 970..1013 CDD:238021 5/15 (33%)
FU 1017..1067 CDD:238021 16/55 (29%)
FU 1063..1106 CDD:214589 0/42 (0%)
GF_recep_IV 1068..1232 CDD:291509 35/170 (21%)
FU 1116..1163 CDD:238021 17/46 (37%)
FU 1211..1255 CDD:214589
FU 1259..1301 CDD:214589
FU 1304..1348 CDD:214589
FU 1356..1403 CDD:238021
FU 1401..1444 CDD:214589
Rspo3NP_001094460.1 Furin-like_2 42..144 CDD:292535 37/150 (25%)
FU 97..143 CDD:238021 17/47 (36%)
TSP1 151..202 CDD:214559 9/56 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.