DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur2 and TppII

DIOPT Version :9

Sequence 1:NP_727963.1 Gene:Fur2 / 32604 FlyBaseID:FBgn0004598 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster


Alignment Length:484 Identity:87/484 - (17%)
Similarity:141/484 - (29%) Gaps:213/484 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 HLSFSPESISLASHSQRMEYRDVSSHF---IFPDPLFKEQWYLVSKNGGAKDGLDMNVGPAWQKG 408
            :|.|..|.:    :|....|.|:.:.:   :||                ..||        |   
  Fly   270 NLDFELEML----NSYEKVYGDIKTSYDCILFP----------------TADG--------W--- 303

  Fly   409 YTGKGVVVSILDDGIQTNHPDLAQ--------------NYDPEASFDINGNDSDPTPQDNG-DNK 458
                   ::|:|   .|...||.|              |.|...|..:|.:|.....:..| .:.
  Fly   304 -------LTIVD---TTEQGDLDQALRIGEYSRTHETRNVDDFLSISVNVHDEGNVLEVVGMSSP 358

  Fly   459 HGTRCAGEVAAVAFNNFCG---VGVAYNASIGGVRMLDGK----------VNDVVEAQALSLNPS 510
            |||    .|:::|..|...   .|||.||.|..:.:.||:          |..:.:...|..:..
  Fly   359 HGT----HVSSIASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGR 419

  Fly   511 HIDIYSASWGPEDDGSTVDGPGPLARRAF-IYGV----TSGRQG--------------------- 549
            .||:.:.|:|...:.|.....|.|..... .|||    ::|..|                     
  Fly   420 RIDVINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVG 484

  Fly   550 ------------------KGSIFVWASG----NGGRYTDSCNCDGYTNSI--FTLSISSATQAGF 590
                              .|:::.|.|.    :||:....|...|...|:  ||:|.|...    
  Fly   485 AYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLM---- 545

  Fly   591 KPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALE 655
                                                          .|||.:||..||..||.:.
  Fly   546 ----------------------------------------------NGTSMAAPHVAGAVALLIS 564

  Fly   656 ANPELTWRDMQYLVVYTSRPAPLEKENGWTLNGVKRKYSHKF--GYGLMDAGAMVSLAEQWTSVP 718
            .   |..::::|        :|...:...::...|..|...|  |:||::.....          
  Fly   565 G---LKQQNIEY--------SPYSIKRAISVTATKLGYVDPFAQGHGLLNVEKAF---------- 608

  Fly   719 PQHICKSRE-------------NNEDRKI 734
             :|:.:.|:             ||.|:.|
  Fly   609 -EHLTEHRQSKDNMLRFSVRVGNNADKGI 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur2NP_727963.1 S8_pro-domain 242..318 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 375..674 CDD:173789 68/376 (18%)
Peptidase_S8 411..700 CDD:278510 68/368 (18%)
P_proprotein 761..849 CDD:279782
Furin-like 966..1126 CDD:279142
FU 970..1013 CDD:238021
FU 1017..1067 CDD:238021
FU 1063..1106 CDD:214589
GF_recep_IV 1068..1232 CDD:291509
FU 1116..1163 CDD:238021
FU 1211..1255 CDD:214589
FU 1259..1301 CDD:214589
FU 1304..1348 CDD:214589
FU 1356..1403 CDD:238021
FU 1401..1444 CDD:214589
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 75/424 (18%)
Peptidase_S8 331..600 CDD:278510 62/333 (19%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.