DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur2 and PCSK9

DIOPT Version :9

Sequence 1:NP_727963.1 Gene:Fur2 / 32604 FlyBaseID:FBgn0004598 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_777596.2 Gene:PCSK9 / 255738 HGNCID:20001 Length:692 Species:Homo sapiens


Alignment Length:434 Identity:96/434 - (22%)
Similarity:151/434 - (34%) Gaps:120/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 HHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRK------RDGPYQDLPTYSPYNLLRQHG- 338
            |..:|...|....:...||.|..:    .|.|:..|:      |.|       |....|...|| 
Human    65 HRCAKDPWRLPGTYVVVLKEETHL----SQSERTARRLQAQAARRG-------YLTKILHVFHGL 118

  Fly   339 --GYVVDPN----------PHLSFSPESISLASHSQRMEYRDVSSHFIFPDPLFKEQWYLVSKNG 391
              |::|..:          ||:.:..|..|:.:.|.......::      .|.::...|      
Human   119 LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERIT------PPRYRADEY------ 171

  Fly   392 GAKDGLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQDNGD 456
            ...||              |..|.|.:||..||::|.::...        :...|.:..|:::|.
Human   172 QPPDG--------------GSLVEVYLLDTSIQSDHREIEGR--------VMVTDFENVPEEDGT 214

  Fly   457 ---------NKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGKVNDVVEAQALSLNPSHI 512
                     :.|||..||.|:.      ...|||..||:..:|:|:.:....|....:.|     
Human   215 RFHRQASKCDSHGTHLAGVVSG------RDAGVAKGASMRSLRVLNCQGKGTVSGTLIGL----- 268

  Fly   513 DIYSASWGPEDDGSTVDGPGPL-------ARRAFIYGVTSGRQGK-GSIFVWASGNGGRYTDSC- 568
            :....|       ..|...|||       ...:.:......|..: |.:.|.|:||  ...|:| 
Human   269 EFIRKS-------QLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGN--FRDDACL 324

  Fly   569 NCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSS----GTPGHDKSVATVDMDGSLRPD 629
            ........:.|:   .||.|..:|..|    .||.|.:..    ..||.|...|:.|..      
Human   325 YSPASAPEVITV---GATNAQDQPVTL----GTLGTNFGRCVDLFAPGEDIIGASSDCS------ 376

  Fly   630 HICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTS 673
             .|.|..:|||.:|...|||.|:.|.|.||||..:::..:::.|
Human   377 -TCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur2NP_727963.1 S8_pro-domain 242..318 CDD:293079 9/42 (21%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 375..674 CDD:173789 74/321 (23%)
Peptidase_S8 411..700 CDD:278510 70/285 (25%)
P_proprotein 761..849 CDD:279782
Furin-like 966..1126 CDD:279142
FU 970..1013 CDD:238021
FU 1017..1067 CDD:238021
FU 1063..1106 CDD:214589
GF_recep_IV 1068..1232 CDD:291509
FU 1116..1163 CDD:238021
FU 1211..1255 CDD:214589
FU 1259..1301 CDD:214589
FU 1304..1348 CDD:214589
FU 1356..1403 CDD:238021
FU 1401..1444 CDD:214589
PCSK9NP_777596.2 Inhibitor_I9 77..149 CDD:283552 17/82 (21%)
Peptidases_S8_PCSK9_ProteinaseK_like 156..421 CDD:173790 74/332 (22%)
Peptidase_S8 180..422 CDD:278510 69/282 (24%)
C-terminal domain 450..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.