| Sequence 1: | NP_727963.1 | Gene: | Fur2 / 32604 | FlyBaseID: | FBgn0004598 | Length: | 1682 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001035779.1 | Gene: | Rspo4 / 228770 | MGIID: | 1924467 | Length: | 228 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 51/196 - (26%) |
|---|---|---|---|
| Similarity: | 70/196 - (35%) | Gaps: | 51/196 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1072 NCASCQ--DHPEYCTSCDHHL--------VMHEHKCYSACPLDTY---ETEDNKCAFCHSTCATC 1123
Fly 1124 NGPTDQD-CITCRSSRYAWQNKCLISCPDGFYADKKRLECMPCQEGCK--------TCTSNGVCS 1179
Fly 1180 ECLQNWTLNKRDKCIVSGSEGCSESEFYSQVEGQCRPCHASCGSCNGPADTSCTSCPPNRLLEQS 1244
Fly 1245 R 1245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fur2 | NP_727963.1 | S8_pro-domain | 242..318 | CDD:293079 | |
| Peptidases_S8_Protein_convertases_Kexins_Fur in-like | 375..674 | CDD:173789 | |||
| Peptidase_S8 | 411..700 | CDD:278510 | |||
| P_proprotein | 761..849 | CDD:279782 | |||
| Furin-like | 966..1126 | CDD:279142 | 18/66 (27%) | ||
| FU | 970..1013 | CDD:238021 | |||
| FU | 1017..1067 | CDD:238021 | |||
| FU | 1063..1106 | CDD:214589 | 11/43 (26%) | ||
| GF_recep_IV | 1068..1232 | CDD:291509 | 46/181 (25%) | ||
| FU | 1116..1163 | CDD:238021 | 17/47 (36%) | ||
| FU | 1211..1255 | CDD:214589 | 7/35 (20%) | ||
| FU | 1259..1301 | CDD:214589 | |||
| FU | 1304..1348 | CDD:214589 | |||
| FU | 1356..1403 | CDD:238021 | |||
| FU | 1401..1444 | CDD:214589 | |||
| Rspo4 | NP_001035779.1 | Furin-like_2 | 35..138 | CDD:292535 | 32/108 (30%) |
| FU | 85..128 | 18/45 (40%) | |||
| FU | 85..126 | CDD:214589 | 17/43 (40%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..228 | 3/8 (38%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1404 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||