DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur2 and Rspo1

DIOPT Version :9

Sequence 1:NP_727963.1 Gene:Fur2 / 32604 FlyBaseID:FBgn0004598 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_619624.2 Gene:Rspo1 / 192199 MGIID:2183426 Length:265 Species:Mus musculus


Alignment Length:186 Identity:53/186 - (28%)
Similarity:78/186 - (41%) Gaps:47/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 CHDTCETCAGAGPDSCLTCAPAHLHVID------LAVCLQFCPDGYFENSRN---RTCVPCE-PN 1072
            |...||.|:..  :.||.|:|....:::      :.|||..||.|||: :||   ..|:.|: .:
Mouse    40 CAKGCELCSEV--NGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFD-ARNPDMNKCIKCKIEH 101

  Fly  1073 CASCQDHPEYCTSCDHHLVMHEHKCYSACPLDTYETEDNKCAFCHSTCATCN-------GPTDQD 1130
            |.:|..| .:||.|...|.:|:.:||.|||..:  |..|....|.|. |.|.       ||..:.
Mouse   102 CEACFSH-NFCTKCQEGLYLHKGRCYPACPEGS--TAANSTMECGSP-AQCEMSEWSPWGPCSKK 162

  Fly  1131 CITC--------RSSRYAWQNKCLISCPDGFYA----DKKRLEC----MPCQEGCK 1170
            ...|        |:.|       ::..|.|.:.    .|:..:|    .||.||.|
Mouse   163 RKLCGFRKGSEERTRR-------VLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur2NP_727963.1 S8_pro-domain 242..318 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 375..674 CDD:173789
Peptidase_S8 411..700 CDD:278510
P_proprotein 761..849 CDD:279782
Furin-like 966..1126 CDD:279142 39/124 (31%)
FU 970..1013 CDD:238021
FU 1017..1067 CDD:238021 18/57 (32%)
FU 1063..1106 CDD:214589 16/46 (35%)
GF_recep_IV 1068..1232 CDD:291509 34/127 (27%)
FU 1116..1163 CDD:238021 13/69 (19%)
FU 1211..1255 CDD:214589
FU 1259..1301 CDD:214589
FU 1304..1348 CDD:214589
FU 1356..1403 CDD:238021
FU 1401..1444 CDD:214589
Rspo1NP_619624.2 FU 1 34..85 15/46 (33%)
Furin-like_2 42..144 CDD:292535 35/107 (33%)
FU 2 91..135 15/46 (33%)
FU 100..142 CDD:238021 15/44 (34%)
TSP_1 <151..208 CDD:301595 11/63 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..192 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..265 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.