DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and raver2

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_001338083.4 Gene:raver2 / 797613 ZFINID:ZDB-GENE-090713-1 Length:862 Species:Danio rerio


Alignment Length:272 Identity:70/272 - (25%)
Similarity:114/272 - (41%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 ELEPVEV-----PTETKFSGRNRLYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVD 345
            ||||.|:     .|..:.|.|.::.:.||..|.|:.|:.|:.:.| |:...|.:.:|...|:.:.
Zfish    73 ELEPEEIEKRLEKTRRELSNRRKILIKNLPQDTTNQEVHEILREY-ELKYCFVDRNKGTAFVTLL 136

  Fly   346 YHPNAEKAKRALDGSMRKGRQLRVRFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVD 410
            ....|:.|.|.|..:..:||.:.|:..|..::|.|:||...|:.....:....:|.|||..:...
Zfish   137 NGDQAQDAIRTLHQTSVRGRDINVQLQPTDSLLCVTNLPYTVTATQFQELVRSYGNIERCFLVYS 201

  Fly   411 D-RGKHMGEGIVEFAKKSSASACLRMCNEKCFFLTASLRPCLVDPMEVNDDT--DGLPEKAF-NK 471
            | .|...|.|.||:.||.|||    ....:........|..:|...:||..|  |.|..|.. ..
Zfish   202 DLTGHSKGYGFVEYMKKDSAS----RARSELLGKPMGDRVLMVQWADVNQLTSADHLHSKCLCVD 262

  Fly   472 KMP-DFNQERSIGPRFADPNSFEHEYGSRWKQLHNLFKTKQDALKRELKMEEDKLEAQMEYARYE 535
            ::| ||.          |.....|.:...:|.:.......:.:..|...:.|.:...|.|....|
Zfish   263 RLPLDFE----------DSEELAHIFSESYKPVFCQLAQDEGSPVRGFAVVEYETAEQAEAVLLE 317

  Fly   536 QETELLR-QELR 546
            .:.:|:: ||:|
Zfish   318 MDRQLIQGQEIR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 19/69 (28%)
RRM2_p54nrb_like 377..456 CDD:240779 22/79 (28%)
NOPS_NONA_like 447..546 CDD:240580 22/103 (21%)
GBP_C <508..613 CDD:303769 9/40 (23%)
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
raver2XP_001338083.4 RRM1_RAVER2 95..164 CDD:241108 18/69 (26%)
RRM2_RAVER2 168..244 CDD:241110 22/79 (28%)
RRM_SF 255..352 CDD:327398 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.