DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and RAVER2

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001353094.1 Gene:RAVER2 / 55225 HGNCID:25577 Length:691 Species:Homo sapiens


Alignment Length:211 Identity:54/211 - (25%)
Similarity:89/211 - (42%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GGGAGGAMNSTNMGGGGGGGGGGGPRGGEDFFITQRLRSISGPTFE------------LEPVEVP 293
            |||.|||    .:|...|.|.|.|.||             .||:.|            |.|.||.
Human     8 GGGEGGA----GLGSAAGLGPGPGLRG-------------QGPSAEAHEGAPDPMPAALHPEEVA 55

  Fly   294 T-----ETKFSGRNRLYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKA 353
            .     :.:.|.|.::.|.||..|....|:.::.|.| ::...:.:.:|...|:.:   .|.|:|
Human    56 ARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDY-DLKYCYVDRNKRTAFVTL---LNGEQA 116

  Fly   354 KRALDGSMR---KGRQLRVRFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDD-RGK 414
            :.|:....:   :|:.|.|:..|...:|.::|:....::|...:....:|.|||..:...: .|.
Human   117 QNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGH 181

  Fly   415 HMGEGIVEFAKKSSAS 430
            ..|.|.||:.||..|:
Human   182 SKGYGFVEYMKKDFAA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 17/72 (24%)
RRM2_p54nrb_like 377..456 CDD:240779 15/55 (27%)
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
RAVER2NP_001353094.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 16/55 (29%)
RRM1_RAVER2 70..139 CDD:241108 16/72 (22%)
RRM2_RAVER2 143..219 CDD:241110 15/55 (27%)
RRM3_RAVER2 229..326 CDD:241112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.