DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and Rbm4b

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001007015.2 Gene:Rbm4b / 474154 RGDID:1359343 Length:357 Species:Rattus norvegicus


Alignment Length:126 Identity:40/126 - (31%)
Similarity:65/126 - (51%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 RLYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKAKRALDGSMRKGRQL 367
            :|::|||..:.|:.|:|.:|:.||::.|  .::.||:.|:.::....||.|.|.|......|..:
  Rat     3 KLFIGNLPREATEQEIRSLFEQYGKVLE--CDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNI 65

  Fly   368 RVRFAPN----ATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDDRGKHM--GEGIVE 422
            .|..:.|    :|.|.|.|::|..:|:.|...||.:||:....|..|....||  .|..||
  Rat    66 NVE
ASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 21/67 (31%)
RRM2_p54nrb_like 377..456 CDD:240779 17/48 (35%)
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
Rbm4bNP_001007015.2 RRM1_RBM4 2..68 CDD:241050 20/66 (30%)
RRM2_RBM4 78..144 CDD:241051 18/49 (37%)
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000250 196..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.