DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and Raver2

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_038966220.1 Gene:Raver2 / 362551 RGDID:1307610 Length:785 Species:Rattus norvegicus


Alignment Length:322 Identity:73/322 - (22%)
Similarity:103/322 - (31%) Gaps:119/322 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GNQGGAGNQGGQG--NQGGA----GNQGNGQG--------FRGRNAGNNQG-GGF---------- 221
            |:.|||...|..|  ..|.|    |:.|.|..        ||...||..:. ||.          
  Rat    23 GSPGGAVAPGAPGFERPGRARRARGSVGTGSSPTTSPSPRFRRCPAGRGRSIGGVAVQGVSLSSA 87

  Fly   222 ------------------SGGPQNQQRD----------NRNRSGPRPGGGAGGAMNSTNMG---- 254
                              ||.|:.:...          :.:.:|.|..||||.......:|    
  Rat    88 PPASVAAAPPPPARPCSASGPPRPRAASPLSLPLRSGLSESAAGRREDGGAGRRRGGPGLGIRTL 152

  Fly   255 ---GGGGGG-----GGGG----PRGGEDFFITQRLRSISGPTFELEPVEVPTETKFSGRNRLYVG 307
               ||||.|     ||||    |.||        ..:.:..|...:|.|.|.|....|:      
  Rat   153 CWDGGGGRGARAAPGGGGCAAPPGGG--------CTAAADATGAEQPEENPGEKPAPGQ------ 203

  Fly   308 NLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKAKRALDGSMR---KGRQLRV 369
                                      .|....|.|      |.|:|:.|:....:   :||:|.|
  Rat   204 --------------------------QLPAFVTLL------NGEQAQSAIQRFHQFSFRGRELTV 236

  Fly   370 RFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDD-RGKHMGEGIVEFAKKSSAS 430
            :..|...:|.::||....:.|...:....:|.|||..:...: .|...|.|.||:.||..|:
  Rat   237 QLQPTDALLCITNLPVSFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 11/72 (15%)
RRM2_p54nrb_like 377..456 CDD:240779 16/55 (29%)
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
Raver2XP_038966220.1 RRM_SF <207..240 CDD:418427 10/38 (26%)
RRM2_RAVER2 244..320 CDD:410067 16/55 (29%)
RRM3_RAVER2 330..426 CDD:410069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.