DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and nito

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster


Alignment Length:221 Identity:50/221 - (22%)
Similarity:86/221 - (38%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LEPVEVPTETKFSGRNRLYVGNLTNDITDDELREMFKPYGEISEIF-----SNLDKNFTFLKVDY 346
            ::|.:.|..|:     .|:.|||...|.|||||.:|..||.:.:|.     ......|.|::...
  Fly   304 VQPEDDPLSTR-----TLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQN 363

  Fly   347 HPNAEKAKRALDGSMRKGRQLRVRF--APNATILRVSNLTPFVSNELLYKSFEIFGPIERASITV 409
            ...|.:||..|.|......|.::.:  ...||.:.:..|..:.|...|.:.|:.||.|::...  
  Fly   364 LDMAHRAKIELSGQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEY-- 426

  Fly   410 DDRGKHMGE--GIVEFAKKSSASACLRMCNEKCFFLTASLRPCLVDPMEVNDDTDGLP------- 465
                 ..||  ..:::....:|:|.::  ..:.|.|....|....|..|:...|...|       
  Fly   427 -----QKGEPYAYIQYETVEAATAAVK--EMRGFPLGGPERRLRTDFAELPGATPAAPFKSSKPP 484

  Fly   466 --EKAFNKKMPDFN----QERSIGPR 485
              |.|...:.|:::    :..:..||
  Fly   485 YDESALEYRRPEYDPYYEESAAYAPR 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 22/74 (30%)
RRM2_p54nrb_like 377..456 CDD:240779 15/80 (19%)
NOPS_NONA_like 447..546 CDD:240580 10/52 (19%)
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 23/82 (28%)
RRM3_Spen 397..467 CDD:240756 15/78 (19%)
SPOC 630..789 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.