DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and Krt9

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_703206.2 Gene:Krt9 / 266717 RGDID:628785 Length:662 Species:Rattus norvegicus


Alignment Length:550 Identity:120/550 - (21%)
Similarity:186/550 - (33%) Gaps:166/550 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GNQGGPGNQGG-----------AGNQGGQ-GNQGGAGNQG------NGQGFRGRNAGNNQGGGFS 222
            |..||.|...|           ||..||: |:..|.|..|      .|.|..|.:.|...|||||
  Rat    19 GGGGGRGASRGSMRSSFSRSSRAGGGGGRFGSSSGFGGGGFSACGTGGGGSFGSSYGGGYGGGFS 83

  Fly   223 GGPQNQQRDNRNR------SGPRPGGGAGGAMNSTNMGGGGGGGGGGGPRGGEDFF--------- 272
            .|..:......:|      ||...|||:||     ..|||.|||.|||..|||...         
  Rat    84 AGSSSGMFGGGSRGCFGGGSGGGFGGGSGG-----GFGGGFGGGFGGGSGGGEGSILNTNEKVVM 143

  Fly   273 --ITQRLRSISGPTFELEPVEVPTETKFSGRNRLYVGNLTNDITDDELREMFKPYGE--ISEIFS 333
              :..||.|......|||.                    .|...:.:::|.:...|.  ..:.:|
  Rat   144 QNLNSRLASYMDKVQELEE--------------------DNANLEKQIQEWYSRKGNRVFQKDYS 188

  Fly   334 NLDKNFTFLK---VDYHPNAEKAKRALDGSMRKGRQLRVRFAPNATILR-----VSNLTPFVSNE 390
            :.......||   ||......||...:|.:.......||:.....::.:     ::.|...:.:.
  Rat   189 HYYNTIEDLKDRIVDLTARNNKALIDMDNTRMTLGDFRVKLEMEQSLRQGVDADINGLQKVLDDI 253

  Fly   391 LLYKSFEIFGPIERASITVDDRGKHMGEGIVEFAKKSSASACLRMCNEKCFFLTASLRPCLVDPM 455
            .:.||     .:|....::||..|.:        ||          |.|               .
  Rat   254 NMEKS-----DLEIQFDSLDDELKAL--------KK----------NHK---------------E 280

  Fly   456 EVNDDT---DGLPEKAFNKKMPDFNQERSIGPRFAD----PNSFEHEYGSRWKQLHNLFKTKQDA 513
            |:|..|   ||           |.|.|.::.|. .|    .|....||.      |.:.|.:|| 
  Rat   281 EMNQLTGQNDG-----------DVNVEINVAPS-TDLTQVLNDMREEYE------HLISKNRQD- 326

  Fly   514 LKRELKMEEDKLEAQMEYARYEQETELLRQELRKREVDNERKKLEWEMREKQAEEMRKREEETMR 578
            :::..:.:..::|.|:..:..|.||.:.:....:..|.....:|:.::..|.|  :.|..|:|..
  Rat   327 IEQHYESKMTQIEQQVTNSGQEMETNMKQVSQLQHSVQELNIELQTQLTTKSA--LEKALEDTKN 389

  Fly   579 RH-------------------QTEMQSHMNRQEEDMLRRQQETLFMKAQQLNSLLD--QQE---- 618
            |:                   |...::....||..:|...:..|..:.:....||:  ||:    
  Rat   390 RYCGQLQQIQEQISEMEAQLAQVRAETECQNQEYGLLLSIKTRLEKEIETYRKLLEGGQQDFESS 454

  Fly   619 -----GFGGGGGGNNSTFDNFAGNSNSPFE 643
                 |||.|.|....:..::.|.|...:|
  Rat   455 GAGQIGFGSGKGRQRGSGGSYGGGSGDSYE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 13/74 (18%)
RRM2_p54nrb_like 377..456 CDD:240779 11/83 (13%)
NOPS_NONA_like 447..546 CDD:240580 22/105 (21%)
GBP_C <508..613 CDD:303769 21/123 (17%)
coiled coil 584..595 CDD:293879 2/10 (20%)
coiled coil 603..613 CDD:293879 1/9 (11%)
Krt9NP_703206.2 Filament 138..450 CDD:365827 68/390 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.