Sequence 1: | NP_727962.1 | Gene: | nonA / 32603 | FlyBaseID: | FBgn0004227 | Length: | 742 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_898845.1 | Gene: | Raver2 / 242570 | MGIID: | 2443623 | Length: | 673 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 54/196 - (27%) |
---|---|---|---|
Similarity: | 85/196 - (43%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 GGGGGGGGGGGPRGGEDFFITQRLRSISGPTFE--LEPVEV----PTET---------KFSGRNR 303
Fly 304 LYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKAKRALDGSMR---KGR 365
Fly 366 QLRVRFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDD-RGKHMGEGIVEFAKKSSA 429
Fly 430 S 430 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nonA | NP_727962.1 | RRM1_p54nrb_like | 301..371 | CDD:240778 | 19/72 (26%) |
RRM2_p54nrb_like | 377..456 | CDD:240779 | 16/55 (29%) | ||
NOPS_NONA_like | 447..546 | CDD:240580 | |||
GBP_C | <508..613 | CDD:303769 | |||
coiled coil | 584..595 | CDD:293879 | |||
coiled coil | 603..613 | CDD:293879 | |||
Raver2 | NP_898845.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | 13/38 (34%) | |
RRM_SF | 59..128 | CDD:302621 | 18/72 (25%) | ||
RRM2_RAVER2 | 132..208 | CDD:241110 | 16/55 (29%) | ||
RRM_SF | 218..314 | CDD:302621 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 481..549 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844444 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |