DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and Raver2

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_898845.1 Gene:Raver2 / 242570 MGIID:2443623 Length:673 Species:Mus musculus


Alignment Length:196 Identity:54/196 - (27%)
Similarity:85/196 - (43%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 GGGGGGGGGGGPRGGEDFFITQRLRSISGPTFE--LEPVEV----PTET---------KFSGRNR 303
            ||.||.|.|.||..|           .:|...|  |.|.||    |.|.         :.|.|.:
Mouse     6 GGAGGAGSGSGPSAG-----------TAGEAAEPALRPGEVAALHPQEVAARLQRMRRELSNRRK 59

  Fly   304 LYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKAKRALDGSMR---KGR 365
            :.|.||..|.:..|:.|:.:.| |:...:.:.:|...|:.:   .|.|:|:.|:....:   :||
Mouse    60 ILVKNLPQDSSSQEVHELLQDY-ELKYCYVDRNKRTAFVTL---LNGEQAQSAIQRFHQFSFRGR 120

  Fly   366 QLRVRFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDD-RGKHMGEGIVEFAKKSSA 429
            :|.|:..|...:|.::||....:.|...:....:|.|||..:...: .|...|.|.||:.||..|
Mouse   121 ELTVQLQPTDALLCITNLPISFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFA 185

  Fly   430 S 430
            :
Mouse   186 A 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 19/72 (26%)
RRM2_p54nrb_like 377..456 CDD:240779 16/55 (29%)
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
Raver2NP_898845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 13/38 (34%)
RRM_SF 59..128 CDD:302621 18/72 (25%)
RRM2_RAVER2 132..208 CDD:241110 16/55 (29%)
RRM_SF 218..314 CDD:302621
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 481..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.