DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA and grld-1

DIOPT Version :9

Sequence 1:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_741283.1 Gene:grld-1 / 176827 WormBaseID:WBGene00017929 Length:520 Species:Caenorhabditis elegans


Alignment Length:316 Identity:71/316 - (22%)
Similarity:115/316 - (36%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 GGGGGGPRGGEDFFITQRLRSISGPTFELEPVEVPTETKF-----SGRNRLYVGNLTNDITDDEL 318
            ||.|.|.||                    .|.:.|:..:.     .....|:|||:.:|:.:.|:
 Worm   141 GGSGSGNRG--------------------RPTKEPSTWRLKQDDDEATRTLFVGNMPSDVKEREI 185

  Fly   319 REMFKPYGEISEIF----SNLDKNFTFLKVDYHPNAEKAK-RALDGSMRK-GRQLRVRFAPNATI 377
            |.:|:.:|::.|:.    .|.|..:.|:.......|.:|| ...|..:|. |.::::.:..:...
 Worm   186 RHVFEEHGKVEEVDIKTPINTDAAYAFVMFQTVDQAIQAKAEEQDRPIRAGGSRMKIGYGKSQVS 250

  Fly   378 LR--VSNLTPFVSNELLYKSFEIFGPIERASITVD-DRGKHMGEGIVEFAKKSSASACLRMCNEK 439
            .|  |..|..:...|:|.|:|..||.:|    .:| |.|:.....:.| ...:|..|| |.....
 Worm   251 RRLFVGGLGSWCDKEILQKAFGEFGFVE----NIDYDHGQPYAYVVYE-NTHTSQEAC-RSLRGA 309

  Fly   440 CFFLTASLRPCLVDPMEVNDDTDGLPEK-AFNKKMPDFNQERSIGPRFAD-----PNS------- 491
            |  ::....|.:||..:   |....||| .|.:|     :..|..|..|.     |.|       
 Worm   310 C--ISKGNHPIMVDYAK---DLTAQPEKQQFMRK-----RRASKSPVGASAVRTPPGSPKDVVRN 364

  Fly   492 ---FEHEYGSRWKQLHNLFKTKQDALKRELKMEEDKLEAQMEYARYEQETELLRQE 544
               .|..|.:.|..            |..||..:..::....|.......:|||.|
 Worm   365 FAELEEAYAATWSG------------KMALKKTDYPVKFYRVYGAERLPVKLLRDE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 19/75 (25%)
RRM2_p54nrb_like 377..456 CDD:240779 22/81 (27%)
NOPS_NONA_like 447..546 CDD:240580 25/114 (22%)
GBP_C <508..613 CDD:303769 8/37 (22%)
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
grld-1NP_741283.1 RRM_SF 33..>93 CDD:302621
RRM_SF 167..246 CDD:302621 19/78 (24%)
RRM3_Spen 253..324 CDD:240756 21/78 (27%)
SPOC 376..482 CDD:285043 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.