DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af50 and AT1G60830

DIOPT Version :9

Sequence 1:NP_001245708.1 Gene:U2af50 / 32602 FlyBaseID:FBgn0005411 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001320689.1 Gene:AT1G60830 / 842376 AraportID:AT1G60830 Length:111 Species:Arabidopsis thaliana


Alignment Length:117 Identity:50/117 - (42%)
Similarity:71/117 - (60%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 MLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEG 376
            ||| ||       |.||:::||..:||.|:|||:.||.||:||:.:|..|:|.:.:|.||||...
plant     1 MLQ-PG-------GTPTKIVCLTQVVTADDLRDDAEYADIMEDMSQEGGKFGNLVNVVIPRPNPD 57

  Fly   377 VE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 427
            .: .||.||||:|:..|....||:..:.||||....||..|:..|||.:.::
plant    58 HDPTPGVGKVFLEYADVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDY 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af50NP_001245708.1 RRM1_U2AF65 103..184 CDD:240676
RRM2_U2AF65 218..294 CDD:240677
RRM3_U2AF65 328..415 CDD:240678 39/87 (45%)
AT1G60830NP_001320689.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG0120
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.