DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af50 and AT2G33435

DIOPT Version :9

Sequence 1:NP_001245708.1 Gene:U2af50 / 32602 FlyBaseID:FBgn0005411 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001318342.1 Gene:AT2G33435 / 817909 AraportID:AT2G33435 Length:1325 Species:Arabidopsis thaliana


Alignment Length:520 Identity:139/520 - (26%)
Similarity:218/520 - (41%) Gaps:128/520 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDRERDRERRRHRSRSRD------------------------RHRERS----RDR--RHHRN--- 46
            |.|:||...:|.||||||                        .|.|||    :||  :||.|   
plant   690 KSRQRDLREKRRRSRSRDHGQDRQKRSSPLPRAEKATSRHKRNHEERSENVVKDRSGKHHCNDNE 754

  Fly    47 ----------SRR---------------------------------KPSLYW------------D 56
                      |||                                 |.|..|            |
plant   755 DKVTSTVSNKSRRYSASKSELGGYSPRKRREQASTKAASPPNLSSEKKSAKWGLAATVTAGMFSD 819

  Fly    57 VPPPGFEHITPMQYKAMQASG--QIPASVVPDTPQTAVPVVGST---------ITRQARRLYVGN 110
            ....|.:..|...|..:..:.  .:...:|.|.|....|...:|         .||:.||||..|
plant   820 SVFSGLQAATQTAYPTISEASLTLLKPLMVMDAPFRTPPARQTTSFDSVQLTESTRRMRRLYAEN 884

  Fly   111 IPFGVTEEEMMEFFNQQMHLVGLAQAAGS-PVLACQINLDKNFAFLEFRSIDETTQAMAFDGINL 174
            :|...:|:.::|.||..|...|.....|| |.::|.||.:|:.|.:||.:..:.:.|::.||.:.
plant   885 VPDSASEKSLIECFNGYMLSSGSNHIKGSEPCISCIINKEKSQALVEFLTPQDASAALSLDGCSF 949

  Fly   175 KGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLL 239
            .|.:||||||.||..    |....::....::..:|..|.||.:||||||....::.:.:.|::.
plant   950 AGSNLKIRRPKDYVR----TTNGELEKKEPAANAVSDNVEDSSNKIFIGGFSKAISSEMLMEIVS 1010

  Fly   240 SFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNA 304
            .||.|:|:..|.:  ..|::..||.||.|.|:|.::.||||||:||..   |..|.....:|.:.
plant  1011 VFGPLKAYRFVSN--NDLNQRCAFLEYTDGSVTLKACAGLNGMRLGGS---VITAVCAFPDASSV 1070

  Fly   305 ANTTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELR--DEEEYEDILEDIKEECTKYGVVRS 367
            |.........:|..:..:. |.|..:|.|.|:|.|::|.  .|:|.::||||::.||.::||::|
plant  1071 AVNENPPFYGIPSHAKPLL-GKPKNILKLKNVVDPEDLTSFSEQEVKEILEDVRLECARFGVIKS 1134

  Fly   368 VEI------------PRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPD 420
            :.|            ..|:..:|.....::.|   ||:: :|.:.:......:|.|.:.....||
plant  1135 INILEHKSKDITVSETNPLLNLESTDSKEMNV---SVIE-EKDEGSEKAEDIADNVDLAEVVMPD 1195

  Fly   421  420
            plant  1196  1195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af50NP_001245708.1 RRM1_U2AF65 103..184 CDD:240676 30/81 (37%)
RRM2_U2AF65 218..294 CDD:240677 29/75 (39%)
RRM3_U2AF65 328..415 CDD:240678 26/100 (26%)
AT2G33435NP_001318342.1 PTZ00121 <3..783 CDD:173412 23/92 (25%)
U2AF_lg 681..1137 CDD:273727 128/456 (28%)
RRM_SF <1275..1311 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0120
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.