DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af50 and CG10466

DIOPT Version :10

Sequence 1:NP_001245708.1 Gene:U2af50 / 32602 FlyBaseID:FBgn0005411 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:98 Identity:27/98 - (27%)
Similarity:50/98 - (51%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 IFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQL 284
            ||:.|.|..|.:..:..:...:|::...||::|:.||.|||:.|..|.|...|..::..|||:::
  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100

  Fly   285 GDKKLIVQRASVGAKNAQNAANTTQSVMLQVPG 317
            .|:.|.|...:......:|.....:::.|.:.|
  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRLYMEG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af50NP_001245708.1 U2AF_lg <50..427 CDD:273727 27/98 (28%)
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 24/76 (32%)

Return to query results.
Submit another query.