DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af50 and UHMK1

DIOPT Version :10

Sequence 1:NP_001245708.1 Gene:U2af50 / 32602 FlyBaseID:FBgn0005411 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_787062.1 Gene:UHMK1 / 127933 HGNCID:19683 Length:419 Species:Homo sapiens


Alignment Length:98 Identity:47/98 - (47%)
Similarity:65/98 - (66%) Gaps:5/98 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 PTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNS 391
            ||.||.|||::..|.|.:||||||::||:||||.|||.|.|:.:|:     |.||.|:||||:.:
Human   319 PTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPK-----ENPGRGQVFVEYAN 378

  Fly   392 VLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHR 424
            ..|.:.||:.||||.|..:.||.:::....|.|
Human   379 AGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af50NP_001245708.1 U2AF_lg <50..427 CDD:273727 47/98 (48%)
UHMK1NP_787062.1 STKc_KIS 22..308 CDD:270922
RRM_SF 318..405 CDD:473069 45/90 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.