DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sl and PLCL2

DIOPT Version :10

Sequence 1:NP_476726.2 Gene:sl / 32601 FlyBaseID:FBgn0003416 Length:1236 Species:Drosophila melanogaster
Sequence 2:NP_001137854.1 Gene:PLCL2 / 23228 HGNCID:9064 Length:1127 Species:Homo sapiens


Alignment Length:48 Identity:8/48 - (16%)
Similarity:20/48 - (41%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DERSSSVIRLKSEQVMFLRQVNKHLALVFIMKEDGNEKAGFIDHNFGV 78
            ::.:..::|...|.:..|.::|       |:..|...:...:|.|..:
Human    18 EKETRKIMRALLEVICTLHKLN-------IVHRDLKPENILLDDNMNI 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slNP_476726.2 PH_PLC_gamma 22..147 CDD:270168 8/48 (17%)
EFh_PI-PLCgamma 152..311 CDD:320031
EF-hand motif 152..191 CDD:320031
EF-hand motif 198..226 CDD:320031
EF-hand motif 230..265 CDD:320031
EF-hand motif 277..311 CDD:320031
PI-PLCc_gamma 323..>470 CDD:176534
SH2_N-SH2_PLC_gamma_like 584..682 CDD:199829
SH2_C-SH2_PLC_gamma_like 696..796 CDD:198186
SH3_PLCgamma 828..880 CDD:212759
PLCYc 981..1091 CDD:128454
C2_PLC_like 1109..1215 CDD:175974
PLCL2NP_001137854.1 PH_PLC_eta 143..251 CDD:270170
EFh_PRIP2 271..414 CDD:320053
EF-hand motif 271..300 CDD:320053
EF-hand motif 307..339 CDD:320053
EF-hand motif 343..371 CDD:320053
EF-hand motif 380..414 CDD:320053
PI-PLCc_PRIP_metazoa 425..721 CDD:176539
C2_PLC_like 753..881 CDD:175974
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.