DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sl and plch1

DIOPT Version :10

Sequence 1:NP_476726.2 Gene:sl / 32601 FlyBaseID:FBgn0003416 Length:1236 Species:Drosophila melanogaster
Sequence 2:XP_031758196.1 Gene:plch1 / 100497252 XenbaseID:XB-GENE-6042445 Length:1661 Species:Xenopus tropicalis


Alignment Length:72 Identity:12/72 - (16%)
Similarity:31/72 - (43%) Gaps:16/72 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSIYGVAENGSNYDERSSSVIRLKSEQVMFLRQVNKHLALVFIMKEDGNEKAGFIDHNFGVFKAG 82
            :.|||       :....::||.|.:.:....:..::...::|.:         |::.:|.::|..
 Frog   187 TGIYG-------FPNEPAAVIALNTIKEWLAKNHHEVDRIIFCV---------FLEVDFKIYKKK 235

  Fly    83 IEQVFKV 89
            :.:.|.|
 Frog   236 MNEFFSV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slNP_476726.2 PH_PLC_gamma 22..147 CDD:270168 10/68 (15%)
EFh_PI-PLCgamma 152..311 CDD:320031
EF-hand motif 152..191 CDD:320031
EF-hand motif 198..226 CDD:320031
EF-hand motif 230..265 CDD:320031
EF-hand motif 277..311 CDD:320031
PI-PLCc_gamma 323..>470 CDD:176534
SH2_N-SH2_PLC_gamma_like 584..682 CDD:199829
SH2_C-SH2_PLC_gamma_like 696..796 CDD:198186
SH3_PLCgamma 828..880 CDD:212759
PLCYc 981..1091 CDD:128454
C2_PLC_like 1109..1215 CDD:175974
plch1XP_031758196.1 PH-like 34..140 CDD:473070
EFh_PI-PLC 158..298 CDD:333715 12/72 (17%)
EF-hand motif 158..187 CDD:320050 12/72 (17%)
EF-hand motif 194..223 CDD:320050 4/28 (14%)
EF-hand motif 228..256 CDD:320050 4/15 (27%)
PLN02222 243..876 CDD:177868 12/72 (17%)
EF-hand motif 265..298 CDD:320050
PI-PLCc_GDPD_SF 310..736 CDD:472694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.