DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and RCF1

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_013682.1 Gene:RCF1 / 854978 SGDID:S000004492 Length:159 Species:Saccharomyces cerevisiae


Alignment Length:102 Identity:34/102 - (33%)
Similarity:50/102 - (49%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFR 65
            |.:..:|:  |.:||      |:       |..|::....|:.||||:|||.||.|:.....|.|
Yeast     4 MPSSFDVT--ERDLD------DM-------TFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVR 53

  Fly    66 TGNRKMSQLMMRSRIAAQGFTVMALVVGVVMTYTDKK 102
            .||:..:|...|.|:..|..|::|||.|..:..|..|
Yeast    54 LGNKWKAQYYFRWRVGLQAATLVALVAGSFIYGTSGK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 20/46 (43%)
RCF1NP_013682.1 HIG_1_N 32..81 CDD:398334 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346079
Domainoid 1 1.000 48 1.000 Domainoid score I2997
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto99480
orthoMCL 1 0.900 - - OOG6_103999
Panther 1 1.100 - - LDO PTHR12297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5716
SonicParanoid 1 1.000 - - X4092
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.