DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and AT3G48030

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_190386.1 Gene:AT3G48030 / 823958 AraportID:AT3G48030 Length:349 Species:Arabidopsis thaliana


Alignment Length:77 Identity:37/77 - (48%)
Similarity:49/77 - (63%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VAEVETTKEKL--QRKIKENPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVM 88
            ::.||...|.|  ::|...|||||||.|.|...|||||.:||.||.::.|::||:|:..||.|| 
plant     1 MSSVEPDMEDLFQEKKRVRNPLVPLGALMTAGVLTAGLISFRRGNSQLGQVLMRARVVVQGATV- 64

  Fly    89 ALVVGVVMTYTD 100
            ||:||....|.|
plant    65 ALMVGTGYYYGD 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 26/46 (57%)
AT3G48030NP_190386.1 HIG_1_N 21..69 CDD:398334 27/48 (56%)
COG5540 <95..252 CDD:227827
RING-H2_PA-TM-RING 206..249 CDD:319368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3836
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto3643
orthoMCL 1 0.900 - - OOG6_103999
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.