powered by:
Protein Alignment CG9921 and Higd2a
DIOPT Version :9
Sequence 1: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080209.1 |
Gene: | Higd2a / 67044 |
MGIID: | 1914294 |
Length: | 106 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 41/65 - (63%) |
Similarity: | 50/65 - (76%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGV 94
|..|||..||.:|||:||:|||.|.||||.|||.|..|....||||||:|||||||||:|:::|:
Mouse 33 EGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGL 97
Fly 95 94
Mouse 98 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
74 |
1.000 |
Domainoid score |
I9153 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
84 |
1.000 |
Inparanoid score |
I5168 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG48942 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1307900at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto93193 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103999 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12297 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5716 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4092 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
14 | 13.870 |
|
Return to query results.
Submit another query.