DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and Higd2a

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_080209.1 Gene:Higd2a / 67044 MGIID:1914294 Length:106 Species:Mus musculus


Alignment Length:65 Identity:41/65 - (63%)
Similarity:50/65 - (76%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGV 94
            |..|||..||.:|||:||:|||.|.||||.|||.|..|....||||||:|||||||||:|:::|:
Mouse    33 EGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGL 97

  Fly    95  94
            Mouse    98  97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 32/46 (70%)
Higd2aNP_080209.1 HIG_1_N 47..96 CDD:398334 32/48 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9153
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5168
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48942
OrthoDB 1 1.010 - - D1307900at2759
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto93193
orthoMCL 1 0.900 - - OOG6_103999
Panther 1 1.100 - - LDO PTHR12297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5716
SonicParanoid 1 1.000 - - X4092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.