powered by:
Protein Alignment CG9921 and HIGD1C
DIOPT Version :9
Sequence 1: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016875272.1 |
Gene: | HIGD1C / 613227 |
HGNCID: | 28044 |
Length: | 158 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 23/66 - (34%) |
Similarity: | 38/66 - (57%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 EVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFR-TGNRKMSQLMMRSRIAAQGFTVMALV 91
|.|....:|.||.:::|.||:|.......::.|||..: ..::|||..::..|:|||||.|.|:.
Human 59 EDEGQLSRLIRKSRDSPFVPIGIAGFVTVVSCGLYKLKYRRDQKMSIHLIHMRVAAQGFVVGAVT 123
Fly 92 V 92
:
Human 124 L 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9921 | NP_001259608.1 |
HIG_1_N |
44..91 |
CDD:282450 |
18/47 (38%) |
HIGD1C | XP_016875272.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165142148 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.700 |
|
Return to query results.
Submit another query.