DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and Higd1a

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001344766.1 Gene:Higd1a / 56295 MGIID:1930666 Length:95 Species:Mus musculus


Alignment Length:74 Identity:30/74 - (40%)
Similarity:41/74 - (55%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DLGPVAEVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRIAAQGF 85
            ||...:..|....|..||.||.|.||:|.....|.:..|||..:: ||.|||..::..|:|||||
Mouse     6 DLSLSSYDEGQGSKFIRKAKETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGF 70

  Fly    86 TVMALVVGV 94
            .|.|:.:|:
Mouse    71 VVGAMTLGM 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 21/47 (45%)
Higd1aNP_001344766.1 HIG_1_N 28..76 CDD:309642 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.