powered by:
Protein Alignment CG9921 and higd1c
DIOPT Version :9
Sequence 1: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011329.1 |
Gene: | higd1c / 496791 |
XenbaseID: | XB-GENE-5935687 |
Length: | 93 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 28/67 - (41%) |
Similarity: | 42/67 - (62%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRIAAQGFTVMALVVG 93
:|...||.:|.||:|.||:|.....|.:..|:|..|: |.:|||..::.:|:|||||.|.|:..|
Frog 12 DTVSSKLLKKTKESPFVPIGMAGFLATVAYGVYRIRSRGQQKMSVHIIHTRVAAQGFVVGAMTFG 76
Fly 94 VV 95
|:
Frog 77 VI 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12297 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.100 |
|
Return to query results.
Submit another query.