DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and higd1a

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001011058.1 Gene:higd1a / 496468 XenbaseID:XB-GENE-974391 Length:96 Species:Xenopus tropicalis


Alignment Length:80 Identity:31/80 - (38%)
Similarity:47/80 - (58%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QLRQDLGPVAEVETTK-EKLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRI 80
            |...|..|..:::.:: .||.||.||:|.||:|.....|.:..||:..:: ||.|||..::..|:
 Frog     3 QTSGDALPTYDIDNSQTSKLIRKSKESPFVPIGMAGFAAVVAYGLFKLKSRGNTKMSVHLIHMRV 67

  Fly    81 AAQGFTVMALVVGVV 95
            |||||.|.|:..||:
 Frog    68 AAQGFVVGAMTCGVI 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 20/47 (43%)
higd1aNP_001011058.1 HIG_1_N 29..80 CDD:368011 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.