DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and Higd2a

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001099572.1 Gene:Higd2a / 290999 RGDID:1309691 Length:106 Species:Rattus norvegicus


Alignment Length:65 Identity:41/65 - (63%)
Similarity:50/65 - (76%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGV 94
            |..|||..||.:|||:||:|||.|.||||.|||.|..|....||||||:|||||||||:|:::|:
  Rat    33 EGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGL 97

  Fly    95  94
              Rat    98  97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 32/46 (70%)
Higd2aNP_001099572.1 HIG_1_N 47..96 CDD:398334 32/48 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.