DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and SPAC25B8.07c

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_594467.1 Gene:SPAC25B8.07c / 2542662 PomBaseID:SPAC25B8.07c Length:113 Species:Schizosaccharomyces pombe


Alignment Length:96 Identity:34/96 - (35%)
Similarity:50/96 - (52%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTK-EKLQRKIKENPLVPLGCLATTAALTAGLYNF 64
            ||:|    ||::..:.::|  ...|.:|...:: |||:.....||.:|||||.|.....|..|..
pombe     1 MSSK----LPKKSEENLEL--PTFPASEESLSRSEKLKYVFVRNPFIPLGCLMTVGTFLASGYYI 59

  Fly    65 RTGNRKMSQLMMRSRIAAQGFTVMALVVGVV 95
            |..|..|:...||.|:.:||||:.||...|:
pombe    60 RRENHLMANKFMRYRVMSQGFTLAALAFSVL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 20/46 (43%)
SPAC25B8.07cNP_594467.1 HIG_1_N 39..86 CDD:282450 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3515
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2048
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto101085
orthoMCL 1 0.900 - - OOG6_103999
Panther 1 1.100 - - LDO PTHR12297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5716
SonicParanoid 1 1.000 - - X4092
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.