DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and T20D3.6

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_501643.1 Gene:T20D3.6 / 177762 WormBaseID:WBGene00011859 Length:144 Species:Caenorhabditis elegans


Alignment Length:94 Identity:35/94 - (37%)
Similarity:45/94 - (47%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LDWIQLR-----------QDLGPVAEVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRTG 67
            :.|.|.|           ||:...:..:|......:|...|||||||.||||..|...:......
 Worm    15 IKWTQEREAYRASIPLIPQDMSGGSRGQTASTTALQKALNNPLVPLGMLATTGCLIGMMVATLRR 79

  Fly    68 NRKMSQLMMRSRIAAQGFTVMALVVGVVM 96
            :.:.:|..||.|:.||||||.|||.|.||
 Worm    80 SSRGAQYFMRGRVVAQGFTVAALVGGAVM 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 22/46 (48%)
T20D3.6NP_501643.1 HIG_1_N 55..105 CDD:368011 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166311
Domainoid 1 1.000 48 1.000 Domainoid score I8070
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I4058
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto19026
orthoMCL 1 0.900 - - OOG6_103999
Panther 1 1.100 - - O PTHR12297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5716
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.