DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and M05D6.5

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001254151.1 Gene:M05D6.5 / 174357 WormBaseID:WBGene00010878 Length:143 Species:Caenorhabditis elegans


Alignment Length:63 Identity:29/63 - (46%)
Similarity:37/63 - (58%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVM---TYTDKK 102
            ||.|.||...|||||.....:...|::..:|.||:.||.||.|||.|||.||.:   ||.|::
 Worm    78 NPGVILGMGLTTAALLGMFKSSFLGDKVGAQKMMQYRIMAQFFTVTALVAGVTIFGATYEDEE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 21/46 (46%)
M05D6.5NP_001254151.1 HIG_1_N 78..128 CDD:368011 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103999
Panther 1 1.100 - - LDO PTHR12297
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.