powered by:
Protein Alignment CG9921 and M05D6.5
DIOPT Version :9
Sequence 1: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254151.1 |
Gene: | M05D6.5 / 174357 |
WormBaseID: | WBGene00010878 |
Length: | 143 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 29/63 - (46%) |
Similarity: | 37/63 - (58%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 NPLVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVM---TYTDKK 102
||.|.||...|||||.....:...|::..:|.||:.||.||.|||.|||.||.: ||.|::
Worm 78 NPGVILGMGLTTAALLGMFKSSFLGDKVGAQKMMQYRIMAQFFTVTALVAGVTIFGATYEDEE 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103999 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12297 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.