DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and Higd1c

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_006242434.1 Gene:Higd1c / 102555170 RGDID:7641479 Length:96 Species:Rattus norvegicus


Alignment Length:84 Identity:30/84 - (35%)
Similarity:47/84 - (55%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRQDLGPVAEVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRIAA 82
            :..|....||.|....:|.||.:::|.||:|.....|.|:.|||...: .::|||..::..|:||
  Rat     1 MSSDEWSAAEDEGQLSRLLRKSRDSPFVPVGMAGFVAVLSYGLYKLNSRRDQKMSLHLIHMRVAA 65

  Fly    83 QGFTVMALVVGVVMT-YTD 100
            ||..|.|:.:||:.: |.|
  Rat    66 QGCAVGAVTLGVLYSMYKD 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 19/47 (40%)
Higd1cXP_006242434.1 HIG_1_N 26..74 CDD:282450 19/47 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.