DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9921 and higd1b

DIOPT Version :9

Sequence 1:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_002935610.1 Gene:higd1b / 100491892 XenbaseID:XB-GENE-977604 Length:109 Species:Xenopus tropicalis


Alignment Length:92 Identity:32/92 - (34%)
Similarity:50/92 - (54%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMS 72
            :.:::..|:...|        ||...|||||:|::||||:|.......:..|||..:: |:.|||
 Frog     1 MSKDQDGWVSESQ--------ETVTGKLQRKMKQSPLVPVGLAGFAVIVAYGLYRLKSRGDMKMS 57

  Fly    73 QLMMRSRIAAQGFTVMALVVGVVMTYT 99
            ..::.:|:|||...|.|..:|.  |||
 Frog    58 VHLIHTRVAAQACVVGATALGA--TYT 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 18/47 (38%)
higd1bXP_002935610.1 HIG_1_N 27..78 CDD:368011 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307900at2759
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.