DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and AT3G10300

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001327262.1 Gene:AT3G10300 / 820192 AraportID:AT3G10300 Length:377 Species:Arabidopsis thaliana


Alignment Length:107 Identity:23/107 - (21%)
Similarity:55/107 - (51%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 QQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDG---T 636
            ::|.:...:|::|:.:|:.:.|:::|.:....|||||..:||.:|..|::.|:.::.:..|   .
plant   223 KEFTSLFFSLQNWRSIFERFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFDKSGGRNRA 287

  Fly   637 LRLSDFVSAVIHLTTAF---------NQFHLKNYGQVNVIEV 669
            :...:|:...:.:...:         .||:..||.::.:..|
plant   288 IEYDNFIECCLTVKVCYFHGLGRHILMQFYHLNYSRLFLYNV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 18/75 (24%)
AT3G10300NP_001327262.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2006
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.