DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and AT2G27480

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_180317.3 Gene:AT2G27480 / 817293 AraportID:AT2G27480 Length:228 Species:Arabidopsis thaliana


Alignment Length:58 Identity:16/58 - (27%)
Similarity:33/58 - (56%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 LKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSD 641
            |..|:.:|..|.::::|.:.:.:||||..::|..|.|.:...::.::  .|||.:..|
plant   123 LAQWRAIFNRYDRDRSGKMNSTQLRDAFYNLGCVLPTSVHQLIVSQF--DDGTGKTVD 178

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 16/58 (28%)
AT2G27480NP_180317.3 EFh_PEF_Group_I 56..223 CDD:320055 16/58 (28%)
EF-hand motif 56..85 CDD:320055