DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and SRI

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_003121.1 Gene:SRI / 6717 HGNCID:11292 Length:198 Species:Homo sapiens


Alignment Length:181 Identity:47/181 - (25%)
Similarity:89/181 - (49%) Gaps:12/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 GGPKVKSVCQYEPVY---MQLADENKTINCFELHELLEACLPNDYIKG---CANIDICRQVIALQ 564
            |||......| :|:|   ..:|.::..|:..|    |:.||....|.|   ..|::.||.::::.
Human    23 GGPAFPGQTQ-DPLYGYFAAVAGQDGQIDADE----LQRCLTQSGIAGGYKPFNLETCRLMVSML 82

  Fly   565 DRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQR 629
            ||..||.:.|.:||.....|..|:..|..:..:::|.:..:.|:.||..:||:||...:|.:.:|
Human    83 DRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKR 147

  Fly   630 YIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIKSILS 680
            | ..:|.:...|:::..:.|....:.|..::..|..|:.....|:|:.::|
Human   148 Y-STNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 21/80 (26%)
SRINP_003121.1 EFh_PEF_sorcin 34..198 CDD:320062 43/169 (25%)
EF-hand motif 34..62 CDD:320062 8/31 (26%)
EF-hand motif 74..103 CDD:320062 9/28 (32%)
EF-hand motif 104..133 CDD:320062 6/28 (21%)
EF-hand motif 140..167 CDD:320062 5/27 (19%)
EF-hand motif 169..197 CDD:320062 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.