Sequence 1: | NP_573118.2 | Gene: | CalpC / 32597 | FlyBaseID: | FBgn0260450 | Length: | 681 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103176.1 | Gene: | capns1b / 560033 | ZFINID: | ZDB-GENE-030131-5206 | Length: | 213 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 44/195 - (22%) |
---|---|---|---|
Similarity: | 90/195 - (46%) | Gaps: | 20/195 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 492 DPFPALK--------STDAERCGGPKVKSVCQYEPVYMQLADENKTINCFELHELLEACLP--ND 546
Fly 547 YIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDAL 611
Fly 612 CDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIK 676
Fly 677 676 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CalpC | NP_573118.2 | CysPc | 7..329 | CDD:238004 | |
Calpain_III | 346..483 | CDD:238132 | |||
FRQ1 | <567..648 | CDD:227455 | 18/80 (23%) | ||
capns1b | NP_001103176.1 | EFh | 89..139 | CDD:298682 | 14/49 (29%) |
EFh | 120..209 | CDD:298682 | 17/89 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |