DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and capns1b

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001103176.1 Gene:capns1b / 560033 ZFINID:ZDB-GENE-030131-5206 Length:213 Species:Danio rerio


Alignment Length:195 Identity:44/195 - (22%)
Similarity:90/195 - (46%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 DPFPALK--------STDAERCGGPKVKSVCQYEPVYMQLADENKTINCFELHELLEACLP--ND 546
            ||.|..:        .||.||          |:..|:.|||.::..::..||..:|...:.  .|
Zfish    24 DPPPPKRPLAYASHNETDEER----------QFRKVFQQLAGDDMEVSPKELMTILNKIISKHGD 78

  Fly   547 YIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDAL 611
            ......:|:.||.::|:.|...:|::.|::|.....|:|.||.::|.|..:.:|::.::.|..|.
Zfish    79 LKTDGFSIESCRSMVAVMDSDSTGKLGFEEFNYLWNNIKRWQAIYKTYDADHSGVIGSDELPGAF 143

  Fly   612 CDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIK 676
            ...||.|:..:...:::||..:.|.:...:::..::.|......|...:......|:|.:.:|::
Zfish   144 KAAGFPLNDQLFQLIVRRYSDEKGNMDFDNYIGCLVRLDAMCRAFKTLDKDNNGTIKVDIQEWLQ 208

  Fly   677  676
            Zfish   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 18/80 (23%)
capns1bNP_001103176.1 EFh 89..139 CDD:298682 14/49 (29%)
EFh 120..209 CDD:298682 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.