DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and PEF1

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_036524.1 Gene:PEF1 / 553115 HGNCID:30009 Length:284 Species:Homo sapiens


Alignment Length:154 Identity:35/154 - (22%)
Similarity:68/154 - (44%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 ADENKTINCFELHELLEACLPNDYIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQ 588
            :|.:..|:..||.:.|..|..:.:     |.:.|..:|.:.|::.||||....|......::.|:
Human   128 SDHSGYISMKELKQALVNCNWSSF-----NDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWK 187

  Fly   589 GVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDG--TLRLSDFVSAVIHLTT 651
            .:|:.|.::::|.:....|:.||..:|:.||......|:.||..:..  .::|..|:.....|..
Human   188 NLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQV 252

  Fly   652 AFNQFHLKNYGQVNVIEVHLHDWI 675
            ....|..|:......|.:...|::
Human   253 LTEAFREKDTAVQGNIRLSFEDFV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 20/82 (24%)
PEF1NP_036524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111
9 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P. /evidence=ECO:0000305 21..109
EFh_PEF_peflin 118..283 CDD:320059 35/154 (23%)
EF-hand motif 118..147 CDD:320059 5/18 (28%)
EF-hand motif 155..184 CDD:320059 8/28 (29%)
EF-hand motif 185..215 CDD:320059 7/29 (24%)
Required for interaction with PDCD6. /evidence=ECO:0000269|PubMed:11883899 204..284 16/73 (22%)
EF-hand motif 221..251 CDD:320059 5/29 (17%)
EF-hand motif 252..283 CDD:320059 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.