DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and capns2

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001016161.1 Gene:capns2 / 548915 XenbaseID:XB-GENE-5764367 Length:234 Species:Xenopus tropicalis


Alignment Length:164 Identity:42/164 - (25%)
Similarity:84/164 - (51%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 QYEPVYMQLADENKTINCFELHELLEACLP--NDYIKGCANIDICRQVIALQDRSGSGRITFQQF 577
            |:..::.|||.::..::..||..:|...:.  .|......:.|.||.::|:.|...:|::.|::|
 Frog    66 QFRRLFSQLAGDDMEVSATELMGILNKVIAKHQDLKTDGFSADSCRSMVAVMDSDSTGKLGFEEF 130

  Fly   578 KTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDF 642
            |....|:|.||||:|.|..:::|.:....|..|....||||:..:.:.:|:||..:.|.:...::
 Frog   131 KYLWDNIKKWQGVYKRYDTDRSGTIGRNELPGAFTAAGFQLNGQLYDMIIRRYSDEKGDMDFDNY 195

  Fly   643 VSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIK 676
            :..::.|...|..|...:......|:|.:.:|::
 Frog   196 ICCLVRLDAMFRAFKTLDKDGDGQIKVTIQEWLQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 23/80 (29%)
capns2NP_001016161.1 EFh_PEF_CPNS1_2 66..234 CDD:320063 42/164 (26%)
EF-hand motif 66..94 CDD:320063 7/27 (26%)
EF-hand motif 108..138 CDD:320063 10/29 (34%)
EF-hand motif 139..169 CDD:320063 9/29 (31%)
EF-hand motif 175..203 CDD:320063 4/27 (15%)
EF-hand motif 204..234 CDD:320063 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.