DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and gca

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001005585.1 Gene:gca / 449543 ZFINID:ZDB-GENE-040930-3 Length:205 Species:Danio rerio


Alignment Length:147 Identity:36/147 - (24%)
Similarity:75/147 - (51%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ELLEACLPNDYIKGC---ANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEK 598
            |.|:.||....|.|.   .:::.||.:|||.||..:|::.|.:||.....|..|:..|.|..::.
Zfish    59 EELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNGWKQNFMMVDRDH 123

  Fly   599 AGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQ 663
            :|.:....:..::.::|:::|..:::.:::||.| .|.:...|:|:..:.|....:.|..::..|
Zfish   124 SGTVEPYEMSQSIANMGYRVSPRVLDAIVKRYSR-SGKIYFDDYVACCVKLKALTDHFRRRDTMQ 187

  Fly   664 VNVIEVHLHDWIKSILS 680
            ..::.....|:|...:|
Zfish   188 QGMVNFQYDDFILCTIS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 17/80 (21%)
gcaNP_001005585.1 EFh 52..106 CDD:298682 17/46 (37%)
EFh 82..132 CDD:298682 16/49 (33%)
EFh 116..168 CDD:298682 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.