DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and sri

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_005157918.1 Gene:sri / 393344 ZFINID:ZDB-GENE-040426-1356 Length:190 Species:Danio rerio


Alignment Length:172 Identity:43/172 - (25%)
Similarity:81/172 - (47%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 QYEPVY---MQLADENKTINCFELHELLEACLPNDYIKG---CANIDICRQVIALQDRSGSGRIT 573
            |.:|:|   ..:|.::..|:.    |.|:|||......|   ..|::.||.:|::.||..|..:.
Zfish    23 QQDPLYGYFTAIAGQDGQISA----EELQACLTQANFSGGYRPFNLETCRLMISMLDRDMSYSMG 83

  Fly   574 FQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLR 638
            |.:||.....|..|:..|....::.:|.:..:.:..|:..:|::||...||.:|:|| ...|.:.
Zfish    84 FNEFKELWAVLNGWKQHFMSIDRDMSGTVDPQEMNQAISSMGYRLSPQAMNSIIKRY-SSQGKIT 147

  Fly   639 LSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIKSILS 680
            ..|:|:..:.|.:..:.|..::..|..:......|:|...:|
Zfish   148 FDDYVACCVKLRSLTDVFRKRDQAQQGMATFQYDDFIHCTMS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 20/80 (25%)
sriXP_005157918.1 EFh 37..92 CDD:298682 17/58 (29%)
EFh 67..122 CDD:238008 14/54 (26%)
EFh 101..153 CDD:238008 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.