DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and clpr-2

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001309563.1 Gene:clpr-2 / 3565584 WormBaseID:WBGene00023410 Length:502 Species:Caenorhabditis elegans


Alignment Length:227 Identity:53/227 - (23%)
Similarity:83/227 - (36%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 HGVFRFRLWWCGEWVEVLVDDRLPTINGRLAFMQPQASNCFWAALLEKAIAKLHGSYEALKYGTR 178
            ||:.:.||...|||..:.:|..:|:.:.......|......||||::||.|||.|||..|..|..
 Worm     3 HGIAQIRLLINGEWKVIKIDFHVPSSSASYEIFTPMVRKQAWAALIQKAFAKLGGSYAKLHGGFA 67

  Fly   179 SDGLTDLLGGVVRQM---PILSDN-----IRPQTLKELLTTTCIVTC-LADKSATVAKKNLAERM 234
            ......|.|......   .:.|||     |......:.|.|.|...| ...:...:..||     
 Worm    68 DIAFLQLTGSFTSTYYLNKLSSDNDIWDFILSMQKSKFLVTACSTYCEEGSEEWDIFLKN----- 127

  Fly   235 PNGILVNVNYRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMSKTWERVSQVER 299
                .::.|:..|.||   |.:.:..:||.:         |..|:.|.|....:..|..:.:.:.
 Worm   128 ----QISPNHGYSILD---TKIHEGHRLVLI---------GNFTYSLPDQGTGTLKWGHLPRFDE 176

  Fly   300 ARLIRQLGPGEFWLSFCDFVEIFSTMEVVYLD 331
            ..|...:           |..:.||..:.::|
 Worm   177 KCLCGNI-----------FDYVLSTTSIHWVD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004 52/223 (23%)
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455
clpr-2NP_001309563.1 CysPc <2..212 CDD:381776 53/227 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.