DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and Gca

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001099953.1 Gene:Gca / 295647 RGDID:1306589 Length:220 Species:Rattus norvegicus


Alignment Length:147 Identity:35/147 - (23%)
Similarity:76/147 - (51%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ELLEACLPNDYIKGC---ANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEK 598
            |.|:.||....|.|.   .:::.||.:||:.||..:|::.|.:||.....|.:|:..|....:::
  Rat    74 EELQRCLTQSGISGSYAPFSLETCRIMIAMLDRDYTGKMGFNEFKELWAALNAWKQNFMSIDQDQ 138

  Fly   599 AGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQ 663
            :|.:....|..|:..:|::||...:..:::|| .|:|.:...|:|:..:.|....:.|..:::.|
  Rat   139 SGTVEHHELSQAIALMGYRLSPQTLAAIVRRY-SKNGRIFFDDYVACCVKLRALTDFFRRRDHLQ 202

  Fly   664 VNVIEVHLHDWIKSILS 680
            ..::.....|:::..::
  Rat   203 QGIVNFMYEDFLQGTMT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 19/80 (24%)
GcaNP_001099953.1 Bindin 1..>78 CDD:251078 2/3 (67%)
EFh 67..122 CDD:238008 16/47 (34%)
EF-hand_7 67..120 CDD:290234 16/45 (36%)
EFh 97..152 CDD:298682 16/54 (30%)
EF-hand_7 128..183 CDD:290234 12/55 (22%)
EFh 131..183 CDD:298682 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.