DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and clpr-1

DIOPT Version :10

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_493397.3 Gene:clpr-1 / 189180 WormBaseID:WBGene00012233 Length:252 Species:Caenorhabditis elegans


Alignment Length:232 Identity:59/232 - (25%)
Similarity:81/232 - (34%) Gaps:66/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GEWVEVLVDDRLPTINGRLAFMQPQASNCF-----------WAALLEKAIAKLHGSYEALKYGTR 178
            |||..:.:|           |..||.||.|           |.|.:||..||:..|||.|..|..
 Worm    33 GEWKVLKID-----------FHLPQKSNSFERYAYMVKKQIWVAFIEKGFAKIRKSYEKLSGGVA 86

  Fly   179 SDGLTDLLGGVV-------------RQMPILSDNIRPQTLKELLTTTCIVTCLADKSATVAKKNL 230
            ...|..|.|.:.             |....:.:|...:.:..:.|.|     :.::|   .||.|
 Worm    87 GIALQQLTGAMTFSVFMEKFNNDENRVWEFIQENRNSKFILTVSTPT-----IEEES---EKKQL 143

  Fly   231 AERMPNGILVNVNYRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMS-KTWERV 294
            .|..  ||.....|  |.|| .:..||..:.|:.     .|.|||:         |.| :.|..:
 Worm   144 LEEY--GIRDCHEY--SVLD-AQVYMGHRLILLA-----GSGPFGK---------PKSVRRWGHL 189

  Fly   295 SQVERAR---LIRQLGPGEFWLSFCDFVEIFSTMEVV 328
            ...:..|   ....||..||...:.|..|:|...|.|
 Worm   190 PSYKEIREDWCAVDLGFSEFGTFWIDMSELFQYFEYV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004 59/232 (25%)
Calpain_III 346..483 CDD:238132
EFh_PEF 515..680 CDD:355382
EF-hand motif 515..543 CDD:320054
EF-hand motif 556..585 CDD:320054
EF-hand motif 586..615 CDD:320054
EF-hand motif 622..650 CDD:320054
EF-hand motif 652..680 CDD:320054
clpr-1NP_493397.3 CysPc <28..229 CDD:469591 59/232 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.