DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and clpr-1

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_493397.3 Gene:clpr-1 / 189180 WormBaseID:WBGene00012233 Length:252 Species:Caenorhabditis elegans


Alignment Length:232 Identity:59/232 - (25%)
Similarity:81/232 - (34%) Gaps:66/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GEWVEVLVDDRLPTINGRLAFMQPQASNCF-----------WAALLEKAIAKLHGSYEALKYGTR 178
            |||..:.:|           |..||.||.|           |.|.:||..||:..|||.|..|..
 Worm    33 GEWKVLKID-----------FHLPQKSNSFERYAYMVKKQIWVAFIEKGFAKIRKSYEKLSGGVA 86

  Fly   179 SDGLTDLLGGVV-------------RQMPILSDNIRPQTLKELLTTTCIVTCLADKSATVAKKNL 230
            ...|..|.|.:.             |....:.:|...:.:..:.|.|     :.::|   .||.|
 Worm    87 GIALQQLTGAMTFSVFMEKFNNDENRVWEFIQENRNSKFILTVSTPT-----IEEES---EKKQL 143

  Fly   231 AERMPNGILVNVNYRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMS-KTWERV 294
            .|..  ||.....|  |.|| .:..||..:.|:.     .|.|||:         |.| :.|..:
 Worm   144 LEEY--GIRDCHEY--SVLD-AQVYMGHRLILLA-----GSGPFGK---------PKSVRRWGHL 189

  Fly   295 SQVERAR---LIRQLGPGEFWLSFCDFVEIFSTMEVV 328
            ...:..|   ....||..||...:.|..|:|...|.|
 Worm   190 PSYKEIREDWCAVDLGFSEFGTFWIDMSELFQYFEYV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004 59/232 (25%)
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455
clpr-1NP_493397.3 CysPc <28..229 CDD:381776 59/232 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.